BEKM-1
- CAS No.
- Chemical Name:
- BEKM-1
- Synonyms
- BEKM-1;RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF;PEPTIDE INHIBITOR OF M-TYPE K+ CURRENT
- CBNumber:
- CB9306305
- Molecular Formula:
- C174H267N51O52S6
- Molecular Weight:
- 4097.68
- MDL Number:
- MFCD04974143
- MOL File:
- Mol file
BEKM-1 Chemical Properties,Uses,Production
Enzyme inhibitor
This ERG channel inhibitor (FW = 4091.65 g/mol; CAS 524962-01-4; Soluble to 1 mg/mL in H2O), from the Central Asian scorpion Buthus eupeus, targets human KV11.1 Ether-a-go-go-Related Gene potassium ion currents. BeKm-1 inhibits hERG1 channels (IC50 = 3.3 nM), but has little or no effect, even at 100 nM, on hEAG, hSK1, rSK2, hIK, hBK, KCNQ1/KCNE1, KCNQ2/3, and KCNQ4 channels. BeKm-1 shares a molecular scaffold (consisting of a short a-helix and a triple-stranded antiparallel b-sheet) in common with other short scorpion toxins. Site- directed mutagenesis identified Tyr-11, Lys-18, Arg-20, and Lys-23 as key residues for binding to hERG channels. All four are located in the a-helix and its following loop, whereas the canonical functional site of other short scorpion toxins lies within the b-sheet. BeKm-1 significantly prolongs QTc intervals in isolated rabbit hearts (4.7 at 10 nM, 16.3% at 100 nM), concentrations that inhibit hERG1 channels.
BEKM-1 Preparation Products And Raw materials
Raw materials
Preparation Products
BEKM-1 Suppliers
Supplier | Tel | Country | ProdList | Advantage | |
---|---|---|---|---|---|
Beijing Sizhengbai Biotechnology Co., Ltd. | -- | marketing@4abio.com | CHINA | 6401 | 58 |
Beijing Qunxiao Keyuan Biotechnology Co., Ltd. | -- | mail@qbioscience.com | CHINA | 21 | 58 |
Beijing Bai Ao Si Biotechnology Co., Ltd. | -- | yangmei@bioneeds.net | CHINA | 6999 | 58 |
Beijing Bolide Biotechnology Co., Ltd. | -- | 1985563437@qq.com | CHINA | 6172 | 58 |
Riedel-de Haen AG | -- | United States | 6825 | 87 | |
SIGMA-RBI | -- | Switzerland | 6913 | 91 | |
EMD Biosciences, Inc. | -- | technical@calbiochem.com | United States | 6529 | 66 |