Welcome to chemicalbook!
China English Japan Germany
400-158-6606
18162-48-6872-50-4Methylene ChloridenaphthaleneTHFTitanium Dioxide
Structured search
Inquriy
Try our best to find the right business for you.
Messages
Do not miss inquiry messages Please log in to view all inquiry messages.
My chemicalbook My chemicalbook

Welcome back!

RFQ
skype
MY Account
Top
ChemicalBook >> CAS DataBase List >> CRF (OVINE)

CRF (OVINE)

CRF (OVINE) price.
  • $237.6 - $1820
  • Product name: CRF (OVINE)
  • CAS: 9015-71-8
  • MF: C205H339N59O63S1
  • MW: 4670.31
  • EINECS:
  • MDL Number:MFCD00286536
  • Synonyms:SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2;SER-GLN-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-THR-LYS-ALA-ASP-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-LEU-ASP-ILE-ALA-NH2;SER-GLN-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-THR-LYS-ALA-ASP-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-LEU-ASP-ILE-ALA-NH2 OVINE;corticotropin-releasinghormone ;corticotropin-releasinghormone))- ;CORTICOTROPIN RELEASING FACTOR SHEEP;CORTICOTROPIN RELEASING FACTOR, OVINE;CRF (OVINE)
Price14 Properties Safety Information Description
14 prices
Selected condition：
Brand
  • Alfa Aesar
  • Biorbyt Ltd
  • Sigma-Aldrich
  • Usbiological
Package
  • 10ug
  • 250μg
  • 0.5mg
  • 1mg
  • 5mg
  • 10mg
  • 96Tests
  • ManufacturerAlfa Aesar
  • Product numberJ66708
  • Product descriptionCorticotropin Releasing Factor, ovine
  • Packaging0.5mg
  • Price$258
  • Updated2023-06-20
  • Buy
  • ManufacturerAlfa Aesar
  • Product numberJ66708
  • Product descriptionCorticotropin Releasing Factor, ovine
  • Packaging1mg
  • Price$357
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb611696
  • Product descriptionCorticotropin-releasing factor (ovine)
  • Packaging1mg
  • Price$402.9
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb611696
  • Product descriptionCorticotropin-releasing factor (ovine)
  • Packaging5mg
  • Price$793.9
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb611696
  • Product descriptionCorticotropin-releasing factor (ovine)
  • Packaging10mg
  • Price$1326
  • Updated2021-12-16
  • Buy
  • ManufacturerSigma-Aldrich
  • Product numberC3167
  • Product descriptionCorticotropin Releasing Factor sheep ≥95% (HPLC)
  • Packaging250μg
  • Price$237.6
  • Updated2024-03-01
  • Buy
  • ManufacturerSigma-Aldrich
  • Product numberC3167
  • Product descriptionCorticotropin Releasing Factor sheep ≥95% (HPLC)
  • Packaging0.5mg
  • Price$1040
  • Updated2024-03-01
  • Buy
  • ManufacturerSigma-Aldrich
  • Product numberC3167
  • Product descriptionCorticotropin Releasing Factor sheep ≥95% (HPLC)
  • Packaging1mg
  • Price$1820
  • Updated2024-03-01
  • Buy
  • ManufacturerUsbiological
  • Product number154202
  • Product descriptionCorticotropin Releasing Hormone
  • Packaging10ug
  • Price$333
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product number154199
  • Product descriptionCorticotropin Releasing Hormone
  • Packaging10ug
  • Price$333
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product number154200
  • Product descriptionCorticotropin Releasing Hormone
  • Packaging10ug
  • Price$333
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product number154201
  • Product descriptionCorticotropin Releasing Hormone
  • Packaging10ug
  • Price$336
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product number152446
  • Product descriptionCorticotropin Releasing Hormone
  • Packaging96Tests
  • Price$824
  • Updated2021-12-16
  • Buy
  • ManufacturerUsbiological
  • Product number024435
  • Product descriptionCorticotropin Releasing Hormone
  • Packaging96Tests
  • Price$851
  • Updated2021-12-16
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
Alfa Aesar J66708 Corticotropin Releasing Factor, ovine 0.5mg $258 2023-06-20 Buy
Alfa Aesar J66708 Corticotropin Releasing Factor, ovine 1mg $357 2021-12-16 Buy
Biorbyt Ltd orb611696 Corticotropin-releasing factor (ovine) 1mg $402.9 2021-12-16 Buy
Biorbyt Ltd orb611696 Corticotropin-releasing factor (ovine) 5mg $793.9 2021-12-16 Buy
Biorbyt Ltd orb611696 Corticotropin-releasing factor (ovine) 10mg $1326 2021-12-16 Buy
Sigma-Aldrich C3167 Corticotropin Releasing Factor sheep ≥95% (HPLC) 250μg $237.6 2024-03-01 Buy
Sigma-Aldrich C3167 Corticotropin Releasing Factor sheep ≥95% (HPLC) 0.5mg $1040 2024-03-01 Buy
Sigma-Aldrich C3167 Corticotropin Releasing Factor sheep ≥95% (HPLC) 1mg $1820 2024-03-01 Buy
Usbiological 154202 Corticotropin Releasing Hormone 10ug $333 2021-12-16 Buy
Usbiological 154199 Corticotropin Releasing Hormone 10ug $333 2021-12-16 Buy
Usbiological 154200 Corticotropin Releasing Hormone 10ug $333 2021-12-16 Buy
Usbiological 154201 Corticotropin Releasing Hormone 10ug $336 2021-12-16 Buy
Usbiological 152446 Corticotropin Releasing Hormone 96Tests $824 2021-12-16 Buy
Usbiological 024435 Corticotropin Releasing Hormone 96Tests $851 2021-12-16 Buy

Properties

storage temp. :−20°C
form :Solid

Safety Information

Symbol(GHS):
Signal word:
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
Precautionary statements:

Description

CRH is a key activator of the hypothalamo-pituitaryadrenal (HPA) axis in response to internal or external stresses by stimulating adrenocorticotropic hormone (ACTH) secretion from the pituitary.

More related product prices

Melatonine Superoxide dismutase HEMOGLOBIN

Related product price

Suppliers and manufacturers

Career Henan Chemica Co
AFINE CHEMICALS LIMITED
Hangzhou Go Top Peptide Biotech
Aladdin Scientific GL Biochem (Shanghai) Ltd Chengdu HuaXia Chemical Reagent Co. Ltd Wuxi Zhongkun Biochemical Technology Co., Ltd. Sigma-Aldrich Codow Chemical Co.,Ltd. Shanghai Xilong Biochemical Technology Co., Ltd.