ChemicalBook Chinese Germany Japanese Korean

吉尔生化(上海)有限公司 Company Information

Company Name:    GL Biochem (Shanghai) Ltd
Tel:    21-61263452
Email:    ymbetter@glbiochem.com
Nationality:    China
WebSite:    www.glschina.com/
Product List:    9981
65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100

Product List
Peptide 6A 73549-32-3
Pentagastrin 50 μg/vial (Clinalfa basic)
Proinsulin (31-65), human, Tyr-
Prolactin Releasing Peptides and Related Peptides
Pep1-AGL
Prepro-ANF: 104-116, human
Prepro-Neuromedin S (70-103) (human) 894454-10-5
Prodynorphin: 228-256
Protease Substrates
Polistes Mastoparan 74129-19-4
Pro-Adrenomedullin (12-20) human;KWNKWALSR-NH2 186027-43-0
pp60C-SRC Carboxy-Terminal Phosphoregulatory Peptide, Phosphorylated;TSTEPQ-pY-QPGENL 149299-77-4
Prion Protein (118-135) (human) 202121-03-7
Prion Protein (106 - 126)
Prepro-CNP: 1-27, rat
PLP 41-58
Preptin (rat) 315197-73-0
Prosaptide TX14(A) 196391-82-9
PrP (106-126);KTNMKHMAGAAAAGAVVGGLG 148439-49-0
Pep2m 243843-42-7
Pep4c 243843-43-8
Procollagen Type I (212-216) 149128-48-3
Pro-Adrenomedullin: 153-185, human
Prepro-Atrial Natriuretic Factor (104-123) (human) 112160-83-5
Presenilin-1 (331-349)-Cys (human, mouse) 317335-35-6
Prepro-Nerve Growth Factor (99-115) (mouse)
Peptide 810 156371-22-1
PLM derived peptide??;IRRLSTRRR-OH
Prolactin Releasing Peptide (1-31), HumanPrRP-31
Propionyl-Amyloid β-Protein (31-34) amide
Peptide M 110652-62-5
TRH-Potentiating Peptide
PB1(703-711), Influenza??;SSYRRPVGI
proFIX18??;TVFLDHENANKILNRPKR
Prolactin Releasing Peptide-31 (24-31), bovine: PrRP-
PDGF Antagonist 143784-00-3
Peptide 46 192122-40-0
Peptide B, bovine
PKC (530-558);LLYEMLAGQAPFEGEDEDELFQSIMEHNV-NH2 122613-29-0
Preangiotensinogen (11-14) (human)
pro-ε-Tx1X/12??;LKRTIRTRLNIR
Prosaptide, wild type
Preprogalanin 28-67, rat
Pompilidotoxin, ?- 216064-36-7
Prepro VIP/PHM: 111-122
Prepro VIP: 81-122, human
PEP1;SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2
Platelet-Derived Growth Factor Receptor Substrate 2;SVL-pY-TAVQPNE
Polylysine 25104-18-1
Parathyroid Hormone (PTH) and Related Peptides
PLP 184-199
Prolactin Releasing Peptide-20 (PrRP-20), bovine
proPT18??;HVFLAPQQARSLLQRVRR
Peptide 74
Prolactin Releasing Peptide (1-31), human;SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2 235433-36-0
Pneumadin (rat) 130918-90-0
Pro-Cortistatin (51-81)
Prion Protein (106-126) (human) (scrambled) 150469-23-1
Pep1-TGL
PKI Inhibitor (6-22), amide;TYADFIASGRTGRRNAI-NH2 121932-06-7
Peptide F, bovine
PDGF β-Receptor (719-723) (phosphorylated)
proFIX28??;TVFLDHENANKILNRPKRYNSGKLEEFV
Prolactin Releasing Peptide-31 (PrRP-31), bovine
Protein G B1 Domain (41-56) 160291-75-8
Prolactin Releasing Peptide (12-31), rat;TPDINPAWYTGRGIRPVGRF-NH2 222988-10-5
Pep2-SVKI 328944-75-8
Prepro-adrenomedullin (153-185), human;SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL
Procollagen α1 (1187-1218) (human)
Protease - Activated Receptor2
Platelet-Derived Growth Factor ?-Receptor (739-746);pY-MAPYDNY
Pre-S1 (12-32)
Prepro-TRH (178-199) 122018-92-2
Pep2-EVKI 1315378-67-6
Polyphemusin II-Derived Peptide 229030-20-0
Prolactin Releasing Peptide (1-31), bovine;SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF-NH2
Procathepsin B (36-50) (rat) 317331-26-3
Procathepsin B (26-50) (rat) 317331-27-4
Pedibin Precursor (hydra)
PLP 190-209
Prepro-Neuromedin U (104-136) (human)
proPT28??;HVFLAPQQARSLLQRVRRANTFLEEVRK
Pep2-AVKI 1315378-69-8
Pep 4AK;KKKGSVVIVGRIILSGR-NH2
Parathyroid Hormone (1-34), bovine;AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF 12583-68-5
Peptide F (22-34) (bovine, ovine) 88878-74-4
Prepro VIP/PHM: 156-170 107902-86-3
pTH (28-48) (human) 83286-22-0
Prolactin Releasing Peptide (12-31), bovine;TPDINPAWYAGRGIRPVGRF-NH2
Prepro TRH (53-74)
pTH (1-38) (human) 104218-12-4
Pep2-SVKE 1315378-76-7
Preproenkephalin B (186-204), human
Pro-Cortistatin (28-47)
Prepro Corticotropin Releasing Factor (125-151), human
Prolactin Releasing Peptide (1-31), rat;SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2 215510-06-8
pTH (1-44) (human) 85568-24-7
Pre-S2 (1-26) 104753-45-9
Pol-RFamide 119116-89-1
Proadrenomedullin N-terminal 20 Peptide (Human, 9-20)
65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100

Copyright 2007©  ChemicalBook. All rights reserved.