ChemicalBook Chinese Germany Japanese Korean

吉尔生化(上海)有限公司 Company Information

Company Name:    GL Biochem (Shanghai) Ltd
Tel:    21-61263452
Email:    ymbetter@glbiochem.com
Nationality:    China
WebSite:    www.glschina.com/
Product List:    9981
69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100

Product List
Urocortin III, human 357952-09-1
Urocortin III, mouse, free acid
Thr-Ala-Pro-Arg-Atrial Natriuretic Peptide, Urodilatin, human;TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY(Disulfidebridge:11-27) 115966-23-9
Urokinase substrate, Z-γ-Glu(tBu)-Gly-Arg-pNA
Tax8, HTLV-1 (12-19)??;LFGYPVYV
Tax9, HTLV-1 (11-19??;LLFGYPVYV
Tertiapin
Suc-Tyr-Leu-Val-pNA
Suc-Tyr-Val-Ala-Asp-AMC 201860-29-9
Suc-Tyr-Val-Ala-Asp-pNA 208264-84-0
Suc-Val-Pro-Phe-pNA 95192-11-3
SV40 NLS??;PKKKRKVG
Synapsin I-derived peptide??;LRRRLSDANF-NH2
Syndyphalin SD-33 87636-57-5
T Cell Activation Gene-3 (mouse)
T-7 Peptide
TACE (ADAM-17)
Tachyplesin I
TAT 697226-52-1
TAT 2-4 1159916-66-1
TIP 39, Tuberoinfundibular Neuropeptide;SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP 277302-47-3
TIPP 146369-65-5
TLCK 2364-87-6
Thymic Humoral Gamma 2 Factor
Thymopoietin (TP) Fragments
Thymopoietin I/II (29-41) (bovine) 56795-64-3
Thymopoietin II (32-36)-ethyl ester 283167-49-7
Thymopoietin II (33-36) 75957-56-1
Thymopoietin II (34-36) 75958-14-4
Thymosin and Fragments
Thymosin b4 (16-38) 113318-05-1
Thymosin-α1
Thymosin α1 (deacetylated) (human, bovine, mouse, rat)
Thymosin β10 (human, rat) 88160-82-1
Thymosin β4 (16-38)
Thymosin β4 (human, bovine, horse, rat)
Thymosin-α1, [Ac-Tyr0]-
Thymus and Activation-Regulated Chemokine (human) 439555-96-1
TIMP-2 (145-168) (human, bovine) 1872435-10-3
Thrombin (B 147-158) (human) 207553-42-2
Thrombin Receptor (42-48) Agonist, human;SFLLRNP 145229-76-1
Thrombin Receptor Activator for Peptide 6 (TRAP-6);SFLLRN 141136-83-6
Thrombospondin Analog 143740-28-7
Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
T-F-Q-A-Y-P-L-R-E-A 117592-22-0
TGF α (1-50) (rat)
Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine)
Tos-Gly-Pro-Lys-AMC 128202-25-5
Tos-Gly-Pro-Lys-pNA 73392-19-5
Tos-Gly-Pro-OH 100723-71-5
Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78)
TPCK 402-71-1
Transduction Peptide 1 (α II) Cat #:86740
Transforming Growth Factor β1 Peptide, TGF - β1 (60 - 66), amide
TRAP-14 amide 141923-36-6
TRAP-5
TNF - α (72 - 82), human
TNF-α(78-96) (human)
TNF-α(71-82), human
Tos-Gly-Pro-Arg-AMC · HCl 117961-27-0
Thrombin Receptor Agonist,amide (SFLLR-NH2);SFLLR-NH2 141923-41-3
Thrombin Receptor Agonist (FLLRN);FLLRN 141136-84-7
TRAP-6 amide
TRAP-7
Tyr-Amyloid P Component (27-38) amide 198268-71-2
Tyr-Big Endothelin-1 fragment (22-38) (human) 348128-18-7
Tyr-Leptin (26-39) (human) 309247-25-4
TRH 40216-95-3
Thyrotropin Releasing Hormone, free acid: TRH, free acid;Pyr-HP 34367-54-9
Thyrotropin Releasing Hormone Precursor Peptide: TRH Precursor Peptide;KRQHPGKR
TRH-AMC 190836-86-3
TRH-βNA
Tritrpticin 179264-81-4
Tropoelastin Fragment
Trypanothione
TTA-386 152847-08-0
Tuftsin 72103-53-8
Type B Allatostatin
Tyr-(D-Dab4,Arg5,D-Trp8)-cyclo-Somatostatin-14 (4-11) 496849-46-8
Tyr-(Glu1)-Sauvagine
Tyr0-Secretin (Porcine)
Tyr-ACTH (4-9) 129813-57-6
Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) 185032-24-0
Tyrosinase (192-200)??;SEIWRDIDF 170294-35-6
Tyrosinase (243-251) (human) 197171-78-1
Tyrosine Protein Kinase JAK 2;VLPQDKE-pY-pY-KVKEPGE
Tyr-PDGF A-Chain (194-211) 137132-69-5
Tyr-Proinsulin C-Peptide (55-89) (human)
Tyr-Specific Protein Kinase Inhibitor
Tyr-Uroguanylin (rat)
Tyr-α-CGRP (23-37) (canine, mouse, rat)
Tyr-α-CGRP (human) 124756-98-5
uPAR (84-95) (human)
Uperolein
Urechistachykinin I
Urinary Trypsin Inhibitor Fragment 164859-77-2
Urocortin III, mouse 357952-10-4
Urocortin II, human 398001-88-2
Pentapeptide-1 69558-55-0
Tripeptide-2 64577-63-5
69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100

Copyright 2007©  ChemicalBook. All rights reserved.