ChemicalBook Chinese Germany Japanese Korean

吉尔生化(上海)有限公司 Company Information

Company Name:    GL Biochem (Shanghai) Ltd
Tel:    21-61263452
Email:    ymbetter@glbiochem.com
Nationality:    China
WebSite:    www.glschina.com/
Product List:    9981
60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100

Product List
LHRH-Ⅲ, lamprey
Interleukin Fragments and Related Peptides
Kemptide Negative Control
LHRH, [Des-Gly10,Pro-NHEt9]-
LIP1 (human) 1872435-03-4
Kinase Domain of Insulin Receptor (1);YETD-pY-YRKGGKGL
LHRH (1-5) hydrazide 51871-40-0
L-Carnosine 305-84-0
Lactoferricin B, fragment 4-14
LEAP-2 (38-77) (Human)??;MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE
LHRH (1-2) (free acid) 32159-22-1
Interferon-Inducible T Cell α-Chemoattractant (human) 1927911-33-8
KL-1;LPPVAASSLRND
Invertebrate Tachykinin-I, OctTK-I ??;KPPSSSEFIGLM-NH2
LHRH, [Des-Gly10,D-His2,D-Ser(tBu)6,Pro-NHEt9]-
LHRH, [D-Ser(tBu)6,Aza-Gly10]-
Isovaleryl-Phe-Nle-Sta-Ala-Sta-OH 98092-14-9
Succinyl-(Glu9,Ala11,15)-Endothelin-1 (8-21) 142569-99-1
Leptin (138-167) (human) 313338-97-5
Leucomyosuppressin
Levitide;Pyr-GMIGTLTSKRIKQ-NH2 114281-19-5
KK4A;KKGSVVIVGRIVLSGK
LHRH (1-6) (free acid) 103067-73-8
Intermedin (rat) 1816940-00-7
Lamprey PQRFamide
LHRH II
LHRH-III, lamprey
K-R-Q-H-P-G
LHRH (1-5) (free acid) 52434-75-0
Kinase Domain of Insulin Receptor (4)
Kemptide, amide 89315-28-6
Leptin: 22-56, human 183598-56-3
Isovaleryl-Phe-Lys-pNA · HCl 178894-43-4
LHRH (3-10) 38280-52-3
Intermedin-53 (human) 1140977-96-3
Kisspeptin-54 (human)
LHRH, [D-Lys6]-
LIP2 (human) 1872440-46-4
Leptin (150-167) (human) 200436-46-0
Leupeptin 103476-89-7
Insulin Receptor (1142-1153), pTyr(1146, 1150, 1151);TRDI-pY-ETD-pY-pY-RK
LHRH (1-6) amide 37783-55-4
Kemptide [LKRA-pY-LG], [Lys2, pY5];LKRA-pY-LG-NH2
Leptin: 116-130, mouse 258276-95-8
Interferon-Inducible T Cell α-Chemoattractant (mouse)
Ion Channel Modulators
LHRH, [Des-Gly10,D-Ser(tBu)6,Pro-NHEt9]-
LHRH, [D-Tle6,Pro-NHEt9]-
KEEAE 100929-96-2
Insulin Receptor (1142-1153), pTyr1146;TRDI-pY-ETDYYRK
Lactoferrin N-Lobe (231-245) (human) 169056-32-0
[pSer5]-Kemptide;LRRA-pS-LG
Leptin (126-140) (human) 313220-09-6
LHRH (1-5)-OMe
Leech Osmoregulatory Factor 175413-77-1
LF 20 Consensus Peptide. Anthrax Related Lethal Factor;MLARRKKVYPYPMEPTIAEG-NH2
LCMV gp33–41 151705-84-9
LHRH, [D-Ala6]-
IV9 (476-484), HIV-1 RT Epitope ??;ILKEPVHGV
Ketolide resistance Peptide MRFFV
PKC Substrate Derived from EGF Receptor;KRTLRR 121284-21-7
Isovaleryl-Val-Val-Sta-OEt 120849-36-7
Kisspeptin-54 (27-54) (human) 1135442-77-1
Leu-Enkephalin (sulfated) 80632-52-6
DIPEPTIDE-1 70904-56-2
Leucopyrokinin (4-8): Pheromonotropic Pentapeptide 104191-78-8
Kisspeptin-13 (human) 374675-18-0
Leucomyosuppressin (lms)
Interleukin-6 Receptor (partial)
Lanreotide 108736-35-2
KR-12 (human) 1218951-51-9
LEU-ARG
Lipotropin (61-91), human, ?-
Kinetensin;IARRHPYFL 103131-69-7
L-Anserine · nitrate 10030-52-1
Prodynorphin (228-256), porcine
KALA Amphipathic Peptide
Leucopyrokinin (LPK)
Intermedin (human) 1188922-20-4
Kemptide [LRRASLG];LRRASLG 65189-71-1
Interleukin 1? Converting Enzyme Substrate II
IRS1-derived peptide??;KKSRGDYMTMQIG-NH2
LHRH, [Des-Gly10,D-Trp6,Pro-NHEt9]-
LHRH, [D-Trp6]-
Leu-Valorphin-Arg 135861-77-7
Lys-[Des-Arg9]-Bradykinin 71800-36-7
Leu-pNA 4178-93-2
Lepirudin
LHRH (1-4) (free acid) 77124-58-4
Leptin Fragments and Related Peptides
LHRH, [Des-Gly10,D-Ala6,Pro-NHEt9]-
KGF Receptor Peptide 161338-76-7
Leu-Enkephalin, amide 60117-24-0
Kisspeptin-13 (4-13) (human) 374675-21-5
Leukotriene A4 (LTA4) Hydrolase (365-385) (human)
Kinase Domain of Insulin Receptor (3)
Leptin Receptor Precursor;PFVK-pY-ATLISN
Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine
LHRH , [Des-Gly10, D-Leu6, Pro-NHEt9]-
Interleukin II (60-70)
60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100

Copyright 2007©  ChemicalBook. All rights reserved.